Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIAO3 Peptide - middle region

CIAO3 Peptide - middle region

Product Specifications

Product Name Alternative

PRN, HPRN, IOP1, NAR1, LET1L, NARFL

UniProt

Q9H6Q4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CIAO3 Rabbit Polyclonal Antibody (orb586629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005255558

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MACPSGCLNGGGQLQAPDRPSRELLQHVERLYGMVRAEAPEDAPGVQELY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF4 Polyclonal Antibody
ANT-12909-100ug 100 µg

KLF4 Polyclonal Antibody

Sign In for Pricing
View Details
GENLISA™ Human T-Complex Protein 1 subunit epsilon (CCT5) ELISA
KBH6254 96 Well

GENLISA™ Human T-Complex Protein 1 subunit epsilon (CCT5) ELISA

Sign In for Pricing
View Details
EPSTI1, NT (EPSTI1, Epithelial-stromal interaction protein 1) (PE)
MBS6296139-01 0.2 mL

EPSTI1, NT (EPSTI1, Epithelial-stromal interaction protein 1) (PE)

Sign In for Pricing
View Details
EPSTI1, NT (EPSTI1, Epithelial-stromal interaction protein 1) (PE)
MBS6296139-02 5x 0.2 mL

EPSTI1, NT (EPSTI1, Epithelial-stromal interaction protein 1) (PE)

Sign In for Pricing
View Details
PIGY Antibody
A42237-50UG 50 µg

PIGY Antibody

Sign In for Pricing
View Details
Notch1 Recombinant Rabbit Monoclonal Antibody
orb2283907-01 25 µL

Notch1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details