Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB14 Peptide - C-terminal region

RAB14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB14

UniProt

P61106

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB14 Rabbit Polyclonal Antibody (orb587874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057406

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Interleukin 1 Beta (IL1b), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026510 96 Tests

Multiplex Assay Kit for Interleukin 1 Beta (IL1b), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
IL-17C, His & Avi, Human
Z05446-100 100 µg

IL-17C, His & Avi, Human

Sign In for Pricing
View Details
Guinea-pig CCR8 (Chemokine C-C-Motif Receptor 8) ValidElisa Kit
EK347968 96 Well

Guinea-pig CCR8 (Chemokine C-C-Motif Receptor 8) ValidElisa Kit

Sign In for Pricing
View Details
C1orf80 Polyclonal Antibody, PE-Cy5 Conjugated
bs-9802R-PE-Cy5 100 µL

C1orf80 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
5-Bromo-1,3-dichloro-2-isopropoxybenzene
sc-323391 1 g

5-Bromo-1,3-dichloro-2-isopropoxybenzene

Sign In for Pricing
View Details
BMS-394136
HY-107036-01 1 mg

BMS-394136

Sign In for Pricing
View Details