Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB14 Peptide - C-terminal region

RAB14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB14

UniProt

P61106

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB14 Rabbit Polyclonal Antibody (orb587874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057406

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phf13 (NM_001107995) Rat Tagged Lenti ORF Clone
RR209515L4 10 µg

Phf13 (NM_001107995) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)
MBS1482524-01 0.02 mg (E-Coli)

Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)

Sign In for Pricing
View Details
Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)
MBS1482524-02 0.02 mg (Yeast)

Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)

Sign In for Pricing
View Details
Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)
MBS1482524-03 0.1 mg (E-Coli)

Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)

Sign In for Pricing
View Details
Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)
MBS1482524-04 0.1 mg (Yeast)

Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)

Sign In for Pricing
View Details
Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)
MBS1482524-05 0.02 mg (Baculovirus)

Recombinant Human Poly (A) RNA polymerase, mitochondrial (MTPAP)

Sign In for Pricing
View Details