KCTD15 Peptide - N-terminal region
KCTD15 Peptide - N-terminal region
Product Specifications
Product Name Alternative
KCTD15
UniProt
Q96SI1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KCTD15 Rabbit Polyclonal Antibody (orb587878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005259301
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740994-100 1x 100 µL
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details