Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51 Peptide - C-terminal region

RAD51 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAD51, RAD51A, RECA

UniProt

Q06609

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD51 Rabbit Polyclonal Antibody (orb587879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYSGRGELSARQMHLARFLRMLLRLADEIVSEERKRGNQNLQNLRLSLSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKRD58 (SOWAHD) activation kit by CRISPRa
GA117648 1 Kit

Human ANKRD58 (SOWAHD) activation kit by CRISPRa

Sign In for Pricing
View Details
Vapor Pressure Tester (Reid Method) BPTL-264
BPTL-264 1 Unit

Vapor Pressure Tester (Reid Method) BPTL-264

Sign In for Pricing
View Details
DOT1L Rabbit Polyclonal Antibody
TA375583 100 µL

DOT1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD19 (B-Lymphocyte Marker) (CD19/3116), CF488A conjugate, 0.1mg/mL
BNC883116-500 1x 500 µL

CD19 (B-Lymphocyte Marker) (CD19/3116), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AADAC (NM_001086) Human Over-expression Lysate
LY421330 100 µg

AADAC (NM_001086) Human Over-expression Lysate

Sign In for Pricing
View Details
MRPS11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]
TA802877AM 100 µL

MRPS11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]

Sign In for Pricing
View Details