Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51 Peptide - C-terminal region

RAD51 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAD51, RAD51A, RECA

UniProt

Q06609

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD51 Rabbit Polyclonal Antibody (orb587879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYSGRGELSARQMHLARFLRMLLRLADEIVSEERKRGNQNLQNLRLSLSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHP1 Recombinant Rabbit Monoclonal Antibody [SR41-02]
ET1602-19 100 µL

SHP1 Recombinant Rabbit Monoclonal Antibody [SR41-02]

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF660R conjugate, 0.1mg/mL
BNC610640-500 1x 500 µL

CD34 (QBEnd/10), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Monohydroxyisononyl Phthalate-d4
TRC-M547542-25MG 25 mg

Monohydroxyisononyl Phthalate-d4

Sign In for Pricing
View Details
Recombinant HDAC10 Antibody
RC-15479-01 50 μL

Recombinant HDAC10 Antibody

Sign In for Pricing
View Details
Recombinant HDAC10 Antibody
RC-15479-02 100 µL

Recombinant HDAC10 Antibody

Sign In for Pricing
View Details
Recombinant HDAC10 Antibody
RC-15479-03 1 mL

Recombinant HDAC10 Antibody

Sign In for Pricing
View Details