Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PXN Peptide - N-terminal region

PXN Peptide - N-terminal region

Product Specifications

Product Name Alternative

PXN

UniProt

E7EMK8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PXN Rabbit Polyclonal Antibody (orb587917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005253974

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADGERCWAAGWPRDGGRSSPGGQDEGGGSWPLEEVVLLVSISSSVQEGEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUCKS1 (N-term) Rabbit Polyclonal Antibody
AP52955PU-N 400 µL

NUCKS1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C5orf24 (NM_001135586) Human Recombinant Protein
TP326792 20 µg

C5orf24 (NM_001135586) Human Recombinant Protein

Sign In for Pricing
View Details
HDAC6 Antibody
KC-2339-01 50 μL

HDAC6 Antibody

Sign In for Pricing
View Details
HDAC6 Antibody
KC-2339-02 100 µL

HDAC6 Antibody

Sign In for Pricing
View Details
HDAC6 Antibody
KC-2339-03 1 mL

HDAC6 Antibody

Sign In for Pricing
View Details
FAM228A Antibody
KC-3163-01 50 μL

FAM228A Antibody

Sign In for Pricing
View Details