UFC1 Peptide - N-terminal region
UFC1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
UFC1, CGI-126, HSPC155
UniProt
Q9Y3C8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UFC1 Rabbit Polyclonal Antibody (orb587985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057490
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSV030448 100 µg
Recombinant SARS-CoV-2 Spike RBD (G482S) (His Tag)
Sign In for Pricing
View Details 
BNC681335-500 1x 500 µL
Helicobacter pylori (HP/1335), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
