Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LNX2 Peptide - middle region

LNX2 Peptide - middle region

Product Specifications

Product Name Alternative

LNX2, PDZRN1

UniProt

Q8N448

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LNX2 Rabbit Polyclonal Antibody (orb587988) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_699202

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRERRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ugt2a1 (NM_022228) Rat Tagged Lenti ORF Clone
RR208827L3 10 µg

Ugt2a1 (NM_022228) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DL-beta-prolinol HCl
sc-263100 250 mg

DL-beta-prolinol HCl

Sign In for Pricing
View Details
Lentiviral human CCL25 shRNA (UAS) - Lentiviral human CCL25 shRNA (UAS) (25)
GTR15132293 1 Vial

Lentiviral human CCL25 shRNA (UAS) - Lentiviral human CCL25 shRNA (UAS) (25)

Sign In for Pricing
View Details
CSP (DNAJC5) (NM_025219) Human Tagged Lenti ORF Clone
RC208826L2 10 µg

CSP (DNAJC5) (NM_025219) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD1E Human shRNA Lentiviral Particle (Locus ID 913)
TL305522V 500 µL Each

CD1E Human shRNA Lentiviral Particle (Locus ID 913)

Sign In for Pricing
View Details
MM 419447 10mg
A23158-10 10 mg

MM 419447 10mg

Sign In for Pricing
View Details