Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LNX2 Peptide - middle region

LNX2 Peptide - middle region

Product Specifications

Product Name Alternative

LNX2, PDZRN1

UniProt

Q8N448

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LNX2 Rabbit Polyclonal Antibody (orb587988) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_699202

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRERRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGV

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Plate-Coating Solution
40520012-2 200 mL

ELISA Plate-Coating Solution

Sign In for Pricing
View Details
Nog 3'UTR Luciferase Stable Cell Line
TU114193 1.0 mL

Nog 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mapk8ip1 (NM_053777) Rat Tagged Lenti ORF Clone
RR215656L3 10 µg

Mapk8ip1 (NM_053777) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BID Human Over-expression Lysate
orb1364775 20 µg

BID Human Over-expression Lysate

Sign In for Pricing
View Details
Human RPA-interacting protein (RPAIN) ELISA Kit
abx382885 96 Tests

Human RPA-interacting protein (RPAIN) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human SERPINB3 pAb
PA14051-01 50 μL

Rabbit Anti-Human SERPINB3 pAb

Sign In for Pricing
View Details