RTF2 Peptide - N-terminal region
RTF2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CDAO5, RTFDC1, HSPC164, C20orf43, SHUJUN-3
UniProt
A2A2L6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RTF2 Rabbit Polyclonal Antibody (orb327205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001269966.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKALGKAASHIKSIKNVTELKLSDNPAWEGDKGNTKGDKHDDLQRARFIC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6408093-01 0.1 mL
Bad, Phosphorylated (S136) (Bcl2 Antagonist of Cell Death, BBC2, BCL2L8) (AP)
Sign In for Pricing
View Details MBS6408093-02 5x 0.1 mL
Bad, Phosphorylated (S136) (Bcl2 Antagonist of Cell Death, BBC2, BCL2L8) (AP)
Sign In for Pricing
View Details 
GTR15399900 1 Vial
Lentiviral human TSPYL6 sgRNA gene knockout kit - Lentiviral human TSPYL6 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details