RTF2 Peptide - N-terminal region
RTF2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CDAO5, RTFDC1, HSPC164, C20orf43, SHUJUN-3
UniProt
A2A2L6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RTF2 Rabbit Polyclonal Antibody (orb327205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001269966.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKALGKAASHIKSIKNVTELKLSDNPAWEGDKGNTKGDKHDDLQRARFIC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-H950730-5G 5 g
7-Hydroxy-1,3-naphthalenedisulfonic Acid Dipotassium Salt
Sign In for Pricing
View Details 
E-EL-R0602-01 24 Tests
Rat MIP-1α (Macrophage Inflammatory Protein 1 Alpha) ELISA Kit
Sign In for Pricing
View Details E-EL-R0602-02 48 Tests
Rat MIP-1α (Macrophage Inflammatory Protein 1 Alpha) ELISA Kit
Sign In for Pricing
View Details E-EL-R0602-03 96 Tests
Rat MIP-1α (Macrophage Inflammatory Protein 1 Alpha) ELISA Kit
Sign In for Pricing
View Details 
BNC403792-100 1x 100 µL
Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details