Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHC Peptide - N-terminal region

SDHC Peptide - N-terminal region

Product Specifications

Product Name Alternative

SDHC, CYB560, SDH3

UniProt

Q99643

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDHC Rabbit Polyclonal Antibody (orb585652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRHOXNB (URAD) Human Gene Knockout Kit (CRISPR)
KN425179 1 Kit

PRHOXNB (URAD) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CCL22 / MDC, C-hFc Tag
HA211312-01 20 µg

Human CCL22 / MDC, C-hFc Tag

Sign In for Pricing
View Details
Human CCL22 / MDC, C-hFc Tag
HA211312-02 50 µg

Human CCL22 / MDC, C-hFc Tag

Sign In for Pricing
View Details
Human CCL22 / MDC, C-hFc Tag
HA211312-03 100 µg

Human CCL22 / MDC, C-hFc Tag

Sign In for Pricing
View Details
EIF2S1 Antibody
KC-2207-01 50 μL

EIF2S1 Antibody

Sign In for Pricing
View Details
EIF2S1 Antibody
KC-2207-02 100 µL

EIF2S1 Antibody

Sign In for Pricing
View Details