Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHC Peptide - N-terminal region

SDHC Peptide - N-terminal region

Product Specifications

Product Name Alternative

SDHC, CYB560, SDH3

UniProt

Q99643

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDHC Rabbit Polyclonal Antibody (orb585652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP2 Antibody (Biotin)
KB-16388-01 50 μL

MMP2 Antibody (Biotin)

Sign In for Pricing
View Details
MMP2 Antibody (Biotin)
KB-16388-02 100 µL

MMP2 Antibody (Biotin)

Sign In for Pricing
View Details
MMP2 Antibody (Biotin)
KB-16388-03 1 mL

MMP2 Antibody (Biotin)

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F6]
TA805166AM 100 µL

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F6]

Sign In for Pricing
View Details
Recombinant SAFB Antibody
RC-4610-01 50 μL

Recombinant SAFB Antibody

Sign In for Pricing
View Details
Recombinant SAFB Antibody
RC-4610-02 100 µL

Recombinant SAFB Antibody

Sign In for Pricing
View Details