Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR31 Peptide - C-terminal region

GPR31 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR31

UniProt

O00270

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR31 Rabbit Polyclonal Antibody (orb586546) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005290

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF405S conjugate, 0.1mg/mL
BNC041992-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Aminobenzimidazole
TRC-A630848-5G 5 g

2-Aminobenzimidazole

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), 0.2mg/mL
BNUB1799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), 0.2mg/mL

Sign In for Pricing
View Details
Thumpd2 Mouse Gene Knockout Kit (CRISPR)
KN517549 1 Kit

Thumpd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Rpl29 activation kit by CRISPRa
GA203690 1 Kit

Mouse Rpl29 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant GABA A Receptor beta 2 Antibody
RC-15819-01 50 μL

Recombinant GABA A Receptor beta 2 Antibody

Sign In for Pricing
View Details