Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR31 Peptide - C-terminal region

GPR31 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR31

UniProt

O00270

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR31 Rabbit Polyclonal Antibody (orb586546) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005290

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orotic Acid-15N2 Monohydrate
TRC-O691504-2.5MG 2.5 mg

Orotic Acid-15N2 Monohydrate

Sign In for Pricing
View Details
Human Annexin VIII (ANXA8) activation kit by CRISPRa
GA118825 1 Kit

Human Annexin VIII (ANXA8) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody
HA723945 100 µL

Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GARS1 Human Gene Knockout Kit (CRISPR)
KN402852 1 Kit

GARS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FH Rabbit Polyclonal Antibody
ER1901-10 100 µL

FH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Bright™ Violet 421 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116Q2 50 Tests

Elab Bright™ Violet 421 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details