Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP8L2 Peptide - N-terminal region

TNFAIP8L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TNFAIP8L2

UniProt

Q6P589

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFAIP8L2 Rabbit Polyclonal Antibody (orb586581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF93
E8ER1919-14 100 µL

ZNF93

Sign In for Pricing
View Details
Anti-Drosophila melanogaster (Fruit fly) Pale Antibody
DZ41851 200 µL/Vial

Anti-Drosophila melanogaster (Fruit fly) Pale Antibody

Sign In for Pricing
View Details
Anti-Mannose Binding Lectin (MBL) Monoclonal antibody
FY-AB36863-01 1 mL

Anti-Mannose Binding Lectin (MBL) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Mannose Binding Lectin (MBL) Monoclonal antibody
FY-AB36863-02 100 µL

Anti-Mannose Binding Lectin (MBL) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Mannose Binding Lectin (MBL) Monoclonal antibody
FY-AB36863-03 200 µL

Anti-Mannose Binding Lectin (MBL) Monoclonal antibody

Sign In for Pricing
View Details
PIGR, CT (Polymeric Immunoglobulin Receptor, Poly-Ig Receptor, FLJ22667, Hepatocellular Carcinoma-associated Protein TB6, MGC125361, MGC125362) (AP)
MBS6493410-01 0.2 mL

PIGR, CT (Polymeric Immunoglobulin Receptor, Poly-Ig Receptor, FLJ22667, Hepatocellular Carcinoma-associated Protein TB6, MGC125361, MGC125362) (AP)

Sign In for Pricing
View Details