Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTNA Peptide - C-terminal region

DTNA Peptide - C-terminal region

Product Specifications

Product Name Alternative

DTNA, DRP3

UniProt

Q9Y4J8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DTNA Rabbit Polyclonal Antibody (orb587885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DMVTEDADPYVQPEDENYENDSVRQLENELQMEEYLKQKLQDEAYQVSLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHX35 rabbit pAb
UB-GEN-9083 100 µL

DHX35 rabbit pAb

Sign In for Pricing
View Details
Human KIAA0754 knockout cell line
ABC-KH7827 1 Vial

Human KIAA0754 knockout cell line

Sign In for Pricing
View Details
MAGEA4
E8ER1912-64 100 µL

MAGEA4

Sign In for Pricing
View Details
Rat ADP Ribosylation Factor Like GTPase 4A (ARL4A) ELISA Kit
abx502450 96 Tests

Rat ADP Ribosylation Factor Like GTPase 4A (ARL4A) ELISA Kit

Sign In for Pricing
View Details
4- (1-Methyl-1H-imidazol-5-yl) pyrrolidin-2-one
KDA19891-01 50 mg

4- (1-Methyl-1H-imidazol-5-yl) pyrrolidin-2-one

Sign In for Pricing
View Details
4- (1-Methyl-1H-imidazol-5-yl) pyrrolidin-2-one
KDA19891-02 0.5 g

4- (1-Methyl-1H-imidazol-5-yl) pyrrolidin-2-one

Sign In for Pricing
View Details