Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTNA Peptide - C-terminal region

DTNA Peptide - C-terminal region

Product Specifications

Product Name Alternative

DTNA, DRP3

UniProt

Q9Y4J8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DTNA Rabbit Polyclonal Antibody (orb587885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DMVTEDADPYVQPEDENYENDSVRQLENELQMEEYLKQKLQDEAYQVSLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KHDRBS1 ORF Vector (Human) (pORF)
ORF022196 1.0 µg DNA

KHDRBS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IL6-set siRNA/shRNA/RNAi Lentivector (Human)
24899091 4x 500 ng

IL6-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Bovine triiodothyronine (T3)
QY-E60148 96 Tests

Bovine triiodothyronine (T3)

Sign In for Pricing
View Details
Miconazole Nitrate
sc-205753 1 g

Miconazole Nitrate

Sign In for Pricing
View Details
4- (2-Methoxyphenoxymethyl) benzoic acid
ZFA28868-01 250 mg

4- (2-Methoxyphenoxymethyl) benzoic acid

Sign In for Pricing
View Details
4- (2-Methoxyphenoxymethyl) benzoic acid
ZFA28868-02 2.5 g

4- (2-Methoxyphenoxymethyl) benzoic acid

Sign In for Pricing
View Details