Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FANCC Peptide - N-terminal region

FANCC Peptide - N-terminal region

Product Specifications

Product Name Alternative

FANCC, FAC, FACC

UniProt

Q00597

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FANCC Rabbit Polyclonal Antibody (orb587919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230672

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NeuroD1 Antibody [Alexa Fluor 700]
NBP2-98697AF700 0.1 mL

Rabbit Polyclonal NeuroD1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse Monoclonal VEGF R2/KDR/Flk-1 Antibody (4H3) [PE/Atto594]
NBP1-18644PEATT594 0.1 mL

Mouse Monoclonal VEGF R2/KDR/Flk-1 Antibody (4H3) [PE/Atto594]

Sign In for Pricing
View Details
ARMCX5 Protein Vector (Human) (pPB-C-His)
PV002545 500 ng

ARMCX5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque RELL1 Protein, His (Fc)-Avi-tagged
RELL1-3663R 50 µg

Recombinant Rhesus Macaque RELL1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Bovine Ankyrin repeat domain-containing protein 39 (ANKRD39) ELISA Kit
MBS7220529-01 48 Well

Bovine Ankyrin repeat domain-containing protein 39 (ANKRD39) ELISA Kit

Sign In for Pricing
View Details
Bovine Ankyrin repeat domain-containing protein 39 (ANKRD39) ELISA Kit
MBS7220529-02 96 Well

Bovine Ankyrin repeat domain-containing protein 39 (ANKRD39) ELISA Kit

Sign In for Pricing
View Details