Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GLB1 Peptide - C-terminal region

SH3GLB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SH3GLB1, KIAA0491, CGI-61

UniProt

Q9Y371

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3GLB1 Rabbit Polyclonal Antibody (orb331421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057093

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD105 (Endoglin, TGF beta1,3 Receptor, gp160) (BSA & Azide Free) (HRP)
MBS6266739-01 0.1 mL

CD105 (Endoglin, TGF beta1,3 Receptor, gp160) (BSA & Azide Free) (HRP)

Sign In for Pricing
View Details
CD105 (Endoglin, TGF beta1,3 Receptor, gp160) (BSA & Azide Free) (HRP)
MBS6266739-02 5x 0.1 mL

CD105 (Endoglin, TGF beta1,3 Receptor, gp160) (BSA & Azide Free) (HRP)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii N-succinylarginine dihydrolase (astB)
MBS1431607-01 0.02 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii N-succinylarginine dihydrolase (astB)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii N-succinylarginine dihydrolase (astB)
MBS1431607-02 0.02 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii N-succinylarginine dihydrolase (astB)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii N-succinylarginine dihydrolase (astB)
MBS1431607-03 0.1 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii N-succinylarginine dihydrolase (astB)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii N-succinylarginine dihydrolase (astB)
MBS1431607-04 0.1 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii N-succinylarginine dihydrolase (astB)

Sign In for Pricing
View Details