Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GLB1 Peptide - C-terminal region

SH3GLB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SH3GLB1, KIAA0491, CGI-61

UniProt

Q9Y371

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3GLB1 Rabbit Polyclonal Antibody (orb331421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057093

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HXB1 Polyclonal Antibody
E44H08384 100 µL

HXB1 Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Microtubule-Associated Protein 2 (MAP2) ELISA Kit
MBS9943542-01 48 Well

Sheep Microtubule-Associated Protein 2 (MAP2) ELISA Kit

Sign In for Pricing
View Details
Sheep Microtubule-Associated Protein 2 (MAP2) ELISA Kit
MBS9943542-02 96 Well

Sheep Microtubule-Associated Protein 2 (MAP2) ELISA Kit

Sign In for Pricing
View Details
Sheep Microtubule-Associated Protein 2 (MAP2) ELISA Kit
MBS9943542-03 5x 96 Well

Sheep Microtubule-Associated Protein 2 (MAP2) ELISA Kit

Sign In for Pricing
View Details
Sheep Microtubule-Associated Protein 2 (MAP2) ELISA Kit
MBS9943542-04 10x 96 Well

Sheep Microtubule-Associated Protein 2 (MAP2) ELISA Kit

Sign In for Pricing
View Details
FR alpha Blocking Peptide
MBS822607-01 1 mg

FR alpha Blocking Peptide

Sign In for Pricing
View Details