Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFN1 Peptide - middle region

IGFN1 Peptide - middle region

Product Specifications

Product Name Alternative

IGFN1, EEF1A2BP1, KYIP1

UniProt

Q86VF2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGFN1 Rabbit Polyclonal Antibody (orb327203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YRCTAVNAYGEAACSVRLTVIEVGFRKNRKRHREPQEDLRKELMDFRKLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSU1 Adenovirus (Human)
42806051 1.0 mL

RSU1 Adenovirus (Human)

Sign In for Pricing
View Details
Listeria flaA protein, His Tag
PB115-01 20 µg

Listeria flaA protein, His Tag

Sign In for Pricing
View Details
Listeria flaA protein, His Tag
PB115-02 100 µg

Listeria flaA protein, His Tag

Sign In for Pricing
View Details
FAM118B Antibody, FITC conjugated
A66207-100UG 100 µg

FAM118B Antibody, FITC conjugated

Sign In for Pricing
View Details
2-Chloromandelic acid
TRC-C432673-5G 5 g

2-Chloromandelic acid

Sign In for Pricing
View Details
Mylpf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4649507 1.0 µg DNA

Mylpf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details