Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS2 Peptide - C-terminal region

INTS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

INTS2

UniProt

J3KMZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS2 Rabbit Polyclonal Antibody (orb588030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRDIDPIITRLQQIKEKPSGWSQICKDSSYKNGSRDTGSMDPDVQLCHCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dyrk1a ORF Vector (Rat) (pORF)
ORF066304 1.0 µg DNA

Dyrk1a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
GCSH Antibody
orb2682094-01 50 µL

GCSH Antibody

Sign In for Pricing
View Details
GCSH Antibody
orb2682094-02 100 µL

GCSH Antibody

Sign In for Pricing
View Details
GCSH Antibody
orb2682094-03 200 µL

GCSH Antibody

Sign In for Pricing
View Details
Lentiviral mouse Asb10 shRNA (UAS) - Lentiviral mouse Asb10 shRNA (UAS) plasmid
GTR15104131 1 Vial

Lentiviral mouse Asb10 shRNA (UAS) - Lentiviral mouse Asb10 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Auramycin A
orb2942991-01 10 mg

Auramycin A

Sign In for Pricing
View Details