Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS2 Peptide - C-terminal region

INTS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

INTS2

UniProt

J3KMZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS2 Rabbit Polyclonal Antibody (orb588030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRDIDPIITRLQQIKEKPSGWSQICKDSSYKNGSRDTGSMDPDVQLCHCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pseudin-2 trifluoroacetate salt
FP109889-01 1000 µg

Pseudin-2 trifluoroacetate salt

Sign In for Pricing
View Details
Pseudin-2 trifluoroacetate salt
FP109889-02 2000 µg

Pseudin-2 trifluoroacetate salt

Sign In for Pricing
View Details
Pseudin-2 trifluoroacetate salt
FP109889-03 5000 μg

Pseudin-2 trifluoroacetate salt

Sign In for Pricing
View Details
FAM108A10P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV725080 1.0 µg DNA

FAM108A10P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
C1orf25 ORF Vector (Human) (pORF)
14198011 1.0 µg DNA

C1orf25 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GCN2 Polyclonal Antibody
JOT-AP03509-01 20 µL

GCN2 Polyclonal Antibody

Sign In for Pricing
View Details