Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIP5K1 Peptide - C-terminal region

PPIP5K1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PPIP5K1, HISPPD2A, IP6K, IPS1, KIAA0377, VIP1

UniProt

Q6PFW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPIP5K1 Rabbit Polyclonal Antibody (orb327211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSQASDNP FSPPRTLHSPPLQLQQRSEKPPWYSSGPSSTVSSAGPSSPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody
abx311148-01 20 µg

Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody

Sign In for Pricing
View Details
Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody
abx311148-02 50 µg

Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody

Sign In for Pricing
View Details
Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody
abx311148-03 100 µg

Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody

Sign In for Pricing
View Details
Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody
abx311148-04 200 µg

Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody

Sign In for Pricing
View Details
Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody
abx311148-05 1 mg

Neuroblastoma Breakpoint Family Member 3 (NBPF3) Antibody

Sign In for Pricing
View Details
Olfr644 shRNA (m) Lentiviral Particles
sc-151011-V 200 µL

Olfr644 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details