Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIP5K1 Peptide - C-terminal region

PPIP5K1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PPIP5K1, HISPPD2A, IP6K, IPS1, KIAA0377, VIP1

UniProt

Q6PFW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPIP5K1 Rabbit Polyclonal Antibody (orb327211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSQASDNP FSPPRTLHSPPLQLQQRSEKPPWYSSGPSSTVSSAGPSSPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: right
CS533270 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Myosin-Vb (MYO5B) Human ELISA Kit
F2053 96 Tests

Myosin-Vb (MYO5B) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SERPINF2/α2-antiplasmin Protein, C-10*His (Active)
AHC35601 100 μg

Recombinant Human SERPINF2/α2-antiplasmin Protein, C-10*His (Active)

Sign In for Pricing
View Details
Mouse Rasgef1b ELISA KIT
ELI-41200m 96 Tests

Mouse Rasgef1b ELISA KIT

Sign In for Pricing
View Details
Lentiviral human MPI shRNA (UAS) - Lentiviral human MPI shRNA (UAS, GFP) (100)
GTR15159309 1 Vial

Lentiviral human MPI shRNA (UAS) - Lentiviral human MPI shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Lisinopril EP Impurity I
IL180422-01 2 mg

Lisinopril EP Impurity I

Sign In for Pricing
View Details