Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Peptide - C-terminal region

DNAJC28 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNAJC28, C21orf55, C21orf78

UniProt

Q9NX36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC28 Rabbit Polyclonal Antibody (orb588039) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060303

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHFDAQKEIVRAQKIYETLIKTKEVTDRNPNNLDQGEGEKTPEIKKGFLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Klra2 activation kit by CRISPRa
GA202345 1 Kit

Mouse Klra2 activation kit by CRISPRa

Sign In for Pricing
View Details
Magnesium Bromide
TRC-M110385-5G 5 g

Magnesium Bromide

Sign In for Pricing
View Details
Bapineuzumab Biosimilar - Research Grade
ICH5140-1mg 1 mg

Bapineuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
PLIN2 Polyclonal Antibody
E-AB-13074-01 20 µL

PLIN2 Polyclonal Antibody

Sign In for Pricing
View Details
PLIN2 Polyclonal Antibody
E-AB-13074-02 60 µL

PLIN2 Polyclonal Antibody

Sign In for Pricing
View Details
PLIN2 Polyclonal Antibody
E-AB-13074-03 120 µL

PLIN2 Polyclonal Antibody

Sign In for Pricing
View Details