Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Peptide - C-terminal region

DNAJC28 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNAJC28, C21orf55, C21orf78

UniProt

Q9NX36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC28 Rabbit Polyclonal Antibody (orb588039) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060303

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHFDAQKEIVRAQKIYETLIKTKEVTDRNPNNLDQGEGEKTPEIKKGFLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpn2 Mouse Gene Knockout Kit (CRISPR)
KN515064 1 Kit

Rpn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Usp25 Mouse Gene Knockout Kit (CRISPR)
KN518783 1 Kit

Usp25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Irganox 1035
TRC-I764153-10G 10 g

Irganox 1035

Sign In for Pricing
View Details
Recombinant Porcine COL2A1 Protein (His Tag)
PDMP100003-01 20 µg

Recombinant Porcine COL2A1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Porcine COL2A1 Protein (His Tag)
PDMP100003-02 100 µg

Recombinant Porcine COL2A1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Porcine COL2A1 Protein (His Tag)
PDMP100003-03 500 µg

Recombinant Porcine COL2A1 Protein (His Tag)

Sign In for Pricing
View Details