INTS11 Peptide - N-terminal region
INTS11 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RC68, INT11, RC-68, CPSF3L, CPSF73L
UniProt
Q5TA45
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS11 Rabbit Polyclonal Antibody (orb588041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001243385.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE Anti-Human CD47 Antibody[B6H12]](https://cdn.genprice.uk/products/763/68dd14a6061270361e7d1b1b/imageurl/e-ab-f1413d.webp)
TRC-M321898-500MG 500 mg
Metanilic Acid Sodium Salt (Technical Grade)
Sign In for Pricing
View Details 
BNC743806-100 1x 100 µL
LMO2 (B-Cell Marker) (rLMO2/1971), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details