INTS11 Peptide - N-terminal region
INTS11 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RC68, INT11, RC-68, CPSF3L, CPSF73L
UniProt
Q5TA45
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS11 Rabbit Polyclonal Antibody (orb588041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001243385.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942946-100 1x 100 µL
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![NABP1 Mouse Monoclonal Antibody [Clone ID: OTI6B10]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908a2f/imageurl/cf811088.webp)
CF811088 100 µg
NABP1 Mouse Monoclonal Antibody [Clone ID: OTI6B10]
Sign In for Pricing
View Details 
