DCAF16 Peptide - N-terminal region
DCAF16 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DCAF16, C4orf30
UniProt
Q9NXF7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DCAF16 Rabbit Polyclonal Antibody (orb327218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005248228
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MAG Recombinant Rabbit Monoclonal Antibody [PSH02-42]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea8191b/imageurl/ha721819.webp)
HA721819 100 µL
MAG Recombinant Rabbit Monoclonal Antibody [PSH02-42]
Sign In for Pricing
View Details ![Human Granzyme A Recombinant Rabbit Monoclonal Antibody [PSH09-35] - BSA and Azide free (Detector)](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea82191/imageurl/ha723093.webp)
HA723093 100 µL
Human Granzyme A Recombinant Rabbit Monoclonal Antibody [PSH09-35] - BSA and Azide free (Detector)
Sign In for Pricing
View Details 