DCAF16 Peptide - N-terminal region
DCAF16 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DCAF16, C4orf30
UniProt
Q9NXF7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DCAF16 Rabbit Polyclonal Antibody (orb327218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005248228
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Antizyme inhibitor 1 (AZIN1) Mouse Monoclonal Antibody [Clone ID: OTI1D12]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9089ea/imageurl/cf810984.webp)
CF810984 100 µg
Antizyme inhibitor 1 (AZIN1) Mouse Monoclonal Antibody [Clone ID: OTI1D12]
Sign In for Pricing
View Details ![PE/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]](https://cdn.genprice.uk/products/763/68dd14b0061270361e7d3b50/imageurl/e-ab-f1190i.webp)
E-AB-F1190I-01 50 Tests
PE/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]
Sign In for Pricing
View Details E-AB-F1190I-02 100 Tests
PE/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]
Sign In for Pricing
View Details E-AB-F1190I-03 2x 100 Tests
PE/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]
Sign In for Pricing
View Details 