Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEFF1 Peptide - N-terminal region

TMEFF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TMEFF1, C9orf2

UniProt

Q8IYR6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEFF1 Rabbit Polyclonal Antibody (orb327219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLPEQLYFLQSPPEEEPEYHPDASAQELNVRESDVRVCDESSCKYGGVCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-immunodeficiency virus antibody (HIV-Ab) ELISA Kit
EK12349 48 Tests

Human Anti-immunodeficiency virus antibody (HIV-Ab) ELISA Kit

Sign In for Pricing
View Details
LHFPL6 Human Over-expression Lysate
orb1346701 100 µg

LHFPL6 Human Over-expression Lysate

Sign In for Pricing
View Details
Pack of 250 Sheets of Medium Qualitative Filter, 77X228 Mm
QL03F0823Z Pack of 250

Pack of 250 Sheets of Medium Qualitative Filter, 77X228 Mm

Sign In for Pricing
View Details
Human NMB Protein Lysate
MBS8416092-01 0.02 mg

Human NMB Protein Lysate

Sign In for Pricing
View Details
Human NMB Protein Lysate
MBS8416092-02 5x 0.02 mg

Human NMB Protein Lysate

Sign In for Pricing
View Details
BUD13 (h) -PR
sc-96899-PR 10 µM - 20 µL

BUD13 (h) -PR

Sign In for Pricing
View Details