TMEFF1 Peptide - N-terminal region
TMEFF1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
TMEFF1, C9orf2
UniProt
Q8IYR6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEFF1 Rabbit Polyclonal Antibody (orb327219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MLPEQLYFLQSPPEEEPEYHPDASAQELNVRESDVRVCDESSCKYGGVCK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Wyb2668-200gEcoli 200 µg (E. coli)
Recombinant Neisseria Gonorrhoeae murG Protein (aa 1-355) (strain ATCC 700825 / FA 1090)
Sign In for Pricing
View Details ![3-[ (5,6-Dimethyl-1H-1,3-benzodiazol-1-yl) methyl]furan-2-carboxylic acid](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
UTB29909-01 50 mg
3-[ (5,6-Dimethyl-1H-1,3-benzodiazol-1-yl) methyl]furan-2-carboxylic acid
Sign In for Pricing
View Details UTB29909-02 0.5 g
3-[ (5,6-Dimethyl-1H-1,3-benzodiazol-1-yl) methyl]furan-2-carboxylic acid
Sign In for Pricing
View Details 