What is the catalog number for SLF2 Peptide - middle region?

The catalog number for SLF2 Peptide - middle region is orb2003076.

What sizes are available for SLF2 Peptide - middle region?

SLF2 Peptide - middle region is available in the following size(s): 100 µg.

Is SLF2 Peptide - middle region in stock?

SLF2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SLF2 Peptide - middle region

Product Specifications

Product Name Alternative

C10orf6, FAM178A

UniProt

Q8IX21

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001129595.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKKKHRSPERRKSLFIHENNEKNDRDRGKTNADSKKQTTVAEADIFNNSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS8416279-01 0.02 mg

Human NSUN5C Protein Lysate

Sign In for Pricing

View Details

MBS8416279-02 5x 0.02 mg

Human NSUN5C Protein Lysate

Sign In for Pricing

View Details

32348081 1.0 µg

NUS1P2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing

View Details

374273-01 20 µg

MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S Ribosomal Protein L55, Mitochondrial)

Sign In for Pricing

View Details

374273-02 100 µg

MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S Ribosomal Protein L55, Mitochondrial)

Sign In for Pricing

View Details

374273-03 1 mg

MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S Ribosomal Protein L55, Mitochondrial)

Sign In for Pricing

View Details