SLF2 Peptide - middle region
SLF2 Peptide - middle region
Product Specifications
Product Name Alternative
C10orf6, FAM178A
UniProt
Q8IX21
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001129595.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKKKHRSPERRKSLFIHENNEKNDRDRGKTNADSKKQTTVAEADIFNNSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ExoCaco2 100 Tests
Lyophilized Exosome from Caco2 cell line Standards
Sign In for Pricing
View Details 
AP74433-01 20 µg
Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)
Sign In for Pricing
View Details AP74433-02 100 µg
Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)
Sign In for Pricing
View Details AP74433-03 1 mg
Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)
Sign In for Pricing
View Details