Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM6 Peptide - C-terminal region

TRIM6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRIM6, RNF89

UniProt

Q9C030

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM6 Rabbit Polyclonal Antibody (orb577287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005252841

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-3618 antagomir
HY-RI00739A-01 5 nmol

Hsa-miR-3618 antagomir

Sign In for Pricing
View Details
Hsa-miR-3618 antagomir
HY-RI00739A-02 20 nmol

Hsa-miR-3618 antagomir

Sign In for Pricing
View Details
GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1) (Biotin)
127182-Biotin 100 µL

GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1) (Biotin)

Sign In for Pricing
View Details
Human hemoglobin beta chain
orb1925048 100 µg

Human hemoglobin beta chain

Sign In for Pricing
View Details
Recombinant Human HPD, His-tagged
HPD-13920H 25 µg

Recombinant Human HPD, His-tagged

Sign In for Pricing
View Details
Guinea pig Adipsin ELISA Kit
MBS7211717-01 48 Well

Guinea pig Adipsin ELISA Kit

Sign In for Pricing
View Details