Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM6 Peptide - C-terminal region

TRIM6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRIM6, RNF89

UniProt

Q9C030

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM6 Rabbit Polyclonal Antibody (orb577287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005252841

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TEM7/PLXDC1 Biotinylated Affinity Purified PAb
BAF5327 50 µg

Human TEM7/PLXDC1 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
FOLR3 (Folate Receptor gamma, FR-gamma, Folate Receptor 3)
MBS6006059-01 0.1 mg

FOLR3 (Folate Receptor gamma, FR-gamma, Folate Receptor 3)

Sign In for Pricing
View Details
FOLR3 (Folate Receptor gamma, FR-gamma, Folate Receptor 3)
MBS6006059-02 5x 0.1 mg

FOLR3 (Folate Receptor gamma, FR-gamma, Folate Receptor 3)

Sign In for Pricing
View Details
LSm14B siRNA (m)
sc-149133 10 µM

LSm14B siRNA (m)

Sign In for Pricing
View Details
GDNFRA Polyclonal Antibody, PerCP Conjugated
bs-22346R-PerCP 100 µL

GDNFRA Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
RPL18 Rabbit pAb
orb2715155-01 50 µL

RPL18 Rabbit pAb

Sign In for Pricing
View Details