Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFDN-DT Peptide - C-terminal region

AFDN-DT Peptide - C-terminal region

Product Specifications

Product Name Alternative

AFDN-AS1, C6orf124

UniProt

Q9Y6Z5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AFDN-DT Rabbit Polyclonal Antibody (orb325040) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGTGSGRAVLGLDGRCSIQMGAAGSGRAVLGSVRTGGAGSKWAVLGSAGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEB1 siRNA Oligos set (Human)
27924171 3x 5 nmol

MAGEB1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
SHARPIN Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-9581R-BF750-TR 20 µL

SHARPIN Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Gja10 Antibody - middle region
ARP36629_P050-25UL 25 µL

Gja10 Antibody - middle region

Sign In for Pricing
View Details
Recombinant Citrobacter koseri 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)
MBS1263943-01 0.02 mg (E-Coli)

Recombinant Citrobacter koseri 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)
MBS1263943-02 0.1 mg (E-Coli)

Recombinant Citrobacter koseri 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)
MBS1263943-03 0.02 mg (Yeast)

Recombinant Citrobacter koseri 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)

Sign In for Pricing
View Details