Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFDN-DT Peptide - C-terminal region

AFDN-DT Peptide - C-terminal region

Product Specifications

Product Name Alternative

AFDN-AS1, C6orf124

UniProt

Q9Y6Z5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AFDN-DT Rabbit Polyclonal Antibody (orb325040) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGTGSGRAVLGLDGRCSIQMGAAGSGRAVLGSVRTGGAGSKWAVLGSAGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2941R-BF594-01 20 µL

TNFR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
TNFR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2941R-BF594-02 100 µL

TNFR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
4- (Chloromethyl) -1- (4-chlorophenyl) -1H-1,2,3-triazole
MEA17759-01 50 mg

4- (Chloromethyl) -1- (4-chlorophenyl) -1H-1,2,3-triazole

Sign In for Pricing
View Details
4- (Chloromethyl) -1- (4-chlorophenyl) -1H-1,2,3-triazole
MEA17759-02 0.5 g

4- (Chloromethyl) -1- (4-chlorophenyl) -1H-1,2,3-triazole

Sign In for Pricing
View Details
RGD1562846 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV642495 1.0 µg DNA

RGD1562846 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit anti-human Fatty acid-binding protein, heart
OACA01479-100UG 100 µg

Rabbit anti-human Fatty acid-binding protein, heart

Sign In for Pricing
View Details