Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LONRF1 Peptide - C-terminal region

LONRF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LONRF1, RNF191

UniProt

Q17RB8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LONRF1 Rabbit Polyclonal Antibody (orb578822) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005273742

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMPEREENLQAAPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Labeled Alkaline Phosphatase, 1mL 5nm
GE-03-5 1 mL

Colloidal Gold Labeled Alkaline Phosphatase, 1mL 5nm

Sign In for Pricing
View Details
3-Iodo-tyrosine-13C6
TRC-I728252-5MG 5 mg

3-Iodo-tyrosine-13C6

Sign In for Pricing
View Details
(R)-tert-Butyl 3-(4-Aminophenyl)piperidine-1-carboxylate
TRC-T117595-1G 1 g

(R)-tert-Butyl 3-(4-Aminophenyl)piperidine-1-carboxylate

Sign In for Pricing
View Details
SOX3 Rabbit Polyclonal Antibody
TA367379 100 µL

SOX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N,N'-Dicyclohexylbarbituric Acid
TRC-D358240-250MG 250 mg

N,N'-Dicyclohexylbarbituric Acid

Sign In for Pricing
View Details
TATDN3 (NM_001042553) Human Over-expression Lysate
LY420982 100 µg

TATDN3 (NM_001042553) Human Over-expression Lysate

Sign In for Pricing
View Details