Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LONRF1 Peptide - C-terminal region

LONRF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LONRF1, RNF191

UniProt

Q17RB8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LONRF1 Rabbit Polyclonal Antibody (orb578822) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005273742

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMPEREENLQAAPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Succinyl Chloride
TRC-S688085-2.5G 2.5 g

Succinyl Chloride

Sign In for Pricing
View Details
Panobacumab Biosimilar - Research Grade
ICH5174-1mg 1 mg

Panobacumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS507549 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Striatin (STRN) (NM_003162) Human Recombinant Protein
TP315098L 1 mg

Striatin (STRN) (NM_003162) Human Recombinant Protein

Sign In for Pricing
View Details
Synphilin 1 (SNCAIP) Human Gene Knockout Kit (CRISPR)
KN422425 1 Kit

Synphilin 1 (SNCAIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), Biotin conjugate, 0.1mg/mL
BNCB3775-500 1x 500 µL

IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details