RNF217 Peptide - N-terminal region
RNF217 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RNF217, C6orf172, IBRDC1
UniProt
Q8TC41
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNF217 Rabbit Polyclonal Antibody (orb578828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689766
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1152910 Inquire
Recombinant Alcelaphine herpesvirus 1 Capsid assembly protein 63 (63), partial
Sign In for Pricing
View Details 
117200J1-AAT 500 Tests
IFluor® 700 Anti-human CD172a Antibody *15-414*
Sign In for Pricing
View Details