Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF217 Peptide - N-terminal region

RNF217 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RNF217, C6orf172, IBRDC1

UniProt

Q8TC41

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF217 Rabbit Polyclonal Antibody (orb578828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689766

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD79B Antibody (IGB/1844) [Biotin]
NBP3-08597B 100 µL

Mouse Monoclonal CD79B Antibody (IGB/1844) [Biotin]

Sign In for Pricing
View Details
Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)
MBS1013878-01 0.02 mg (E-Coli)

Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)

Sign In for Pricing
View Details
Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)
MBS1013878-02 0.1 mg (E-Coli)

Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)

Sign In for Pricing
View Details
Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)
MBS1013878-03 0.02 mg (Yeast)

Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)

Sign In for Pricing
View Details
Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)
MBS1013878-04 0.1 mg (Yeast)

Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)

Sign In for Pricing
View Details
Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)
MBS1013878-05 0.02 mg (Baculovirus)

Recombinant Brucella ovis Putative membrane protein insertion efficiency factor (BOV_1039)

Sign In for Pricing
View Details