RNF217 Peptide - N-terminal region
RNF217 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RNF217, C6orf172, IBRDC1
UniProt
Q8TC41
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNF217 Rabbit Polyclonal Antibody (orb578828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689766
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS615240-01 0.1 mg
Sprouty 2 (Sprouty-2, Sprouty Homolog 2 (Drosophila), Spry 2, Spry2, Spry-2, hSPRY2, MGC23039)
Sign In for Pricing
View Details MBS615240-02 5x 0.1 mg
Sprouty 2 (Sprouty-2, Sprouty Homolog 2 (Drosophila), Spry 2, Spry2, Spry-2, hSPRY2, MGC23039)
Sign In for Pricing
View Details 
49831154 3x 1.0 µg DNA
Vmn2r85 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details MBS6386796-01 0.1 mL
Nectin 2 (Nectin-2, AI325026, AI987993, CD112, Herpes Virus Entry Mediator B, Herpes virus Entry Mediator B, HveB, Murine Herpes Virus Entry Protein B, mHveB, Mph, Poliovirus Receptor Homolog, Poliovirus Receptor-related Protein 2, PRR2, Pvr, Pvrl2, Pvs)
Sign In for Pricing
View Details MBS6386796-02 5x 0.1 mL
Nectin 2 (Nectin-2, AI325026, AI987993, CD112, Herpes Virus Entry Mediator B, Herpes virus Entry Mediator B, HveB, Murine Herpes Virus Entry Protein B, mHveB, Mph, Poliovirus Receptor Homolog, Poliovirus Receptor-related Protein 2, PRR2, Pvr, Pvrl2, Pvs)
Sign In for Pricing
View Details