Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF217 Peptide - N-terminal region

RNF217 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RNF217, C6orf172, IBRDC1

UniProt

Q8TC41

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF217 Rabbit Polyclonal Antibody (orb578828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689766

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cc2d1a siRNA Oligos set (Rat)
15152176 3x 5 nmol

Cc2d1a siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal Pref-1/DLK1/FA1 Antibody (PF13-3) [Alexa Fluor 405]
NBP2-80046AF405 0.1 mL

Mouse Monoclonal Pref-1/DLK1/FA1 Antibody (PF13-3) [Alexa Fluor 405]

Sign In for Pricing
View Details
Conditionally Immortalized Rat Cardiac Microvascular Endothelial Cells
ALIMM015 1ml frozen Vial

Conditionally Immortalized Rat Cardiac Microvascular Endothelial Cells

Sign In for Pricing
View Details
Anti-Factor D Picoband antibody
MBS1750579-01 0.01 mg

Anti-Factor D Picoband antibody

Sign In for Pricing
View Details
Anti-Factor D Picoband antibody
MBS1750579-02 0.1 mg (Carrier Free)

Anti-Factor D Picoband antibody

Sign In for Pricing
View Details
Anti-Factor D Picoband antibody
MBS1750579-03 0.1 mg

Anti-Factor D Picoband antibody

Sign In for Pricing
View Details