Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC10 Peptide - C-terminal region

TRAPPC10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRAPPC10

UniProt

Q86SI7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAPPC10 Rabbit Polyclonal Antibody (orb330446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin (UBB) Rabbit Monoclonal Antibody [Clone ID: R02-4I6]
TA385515 100 µL

Ubiquitin (UBB) Rabbit Monoclonal Antibody [Clone ID: R02-4I6]

Sign In for Pricing
View Details
Human FAM200A activation kit by CRISPRa
GA116639 1 Kit

Human FAM200A activation kit by CRISPRa

Sign In for Pricing
View Details
RAPH1 (NM_203365) Human Over-expression Lysate
LC404304 20 µg

RAPH1 (NM_203365) Human Over-expression Lysate

Sign In for Pricing
View Details
Granuphilin (SYTL4) Mouse Monoclonal Antibody [Clone ID: OTI3G3]
CF810590 100 µg

Granuphilin (SYTL4) Mouse Monoclonal Antibody [Clone ID: OTI3G3]

Sign In for Pricing
View Details
Mouse CD30 Recombinant Rabbit monoclonal Antibody
HA723930B 100 µL

Mouse CD30 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Apalutamide Aminocarbonyl
TRC-A726225-25MG 25 mg

Apalutamide Aminocarbonyl

Sign In for Pricing
View Details