Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC10 Peptide - C-terminal region

TRAPPC10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRAPPC10

UniProt

Q86SI7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAPPC10 Rabbit Polyclonal Antibody (orb330446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS701905 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Benzyl-d7 Alcohol
TRC-T536648-10MG 10 mg

Benzyl-d7 Alcohol

Sign In for Pricing
View Details
Phenibut Hydrochloride
TRC-P296970-1G 1 g

Phenibut Hydrochloride

Sign In for Pricing
View Details
MRGPRX4 (NM_054032) Human Over-expression Lysate
LC403295 20 µg

MRGPRX4 (NM_054032) Human Over-expression Lysate

Sign In for Pricing
View Details
T0901317
TRC-T002000-25MG 25 mg

T0901317

Sign In for Pricing
View Details
P53 (mono methyl K382) Antibody
KC-4435-01 50 μL

P53 (mono methyl K382) Antibody

Sign In for Pricing
View Details