OLFML3 Peptide - N-terminal region
OLFML3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
OLFML3, PSEC0035, PSEC0173, PSEC0244, UNQ663/PRO1294
UniProt
Q9NRN5
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OLFML3 Rabbit Polyclonal Antibody (orb580274) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064575
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WSGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-M219022-1MG 1 mg
(2R,5S)-L-Menthol-5-(4-amino-2-oxo-1(2H)-pyrimidinyl-15N2,13C)-1,3-oxathiolane-2-carboxylate
Sign In for Pricing
View Details ![GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: OTI6A3]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90820e/imageurl/cf807985.webp)
CF807985 100 µg
GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: OTI6A3]
Sign In for Pricing
View Details 
BNC740020-500 1x 500 µL
Cytokeratin 19 (A53-B/A2.26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
