OLFML3 Peptide - N-terminal region
OLFML3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
OLFML3, PSEC0035, PSEC0173, PSEC0244, UNQ663/PRO1294
UniProt
Q9NRN5
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OLFML3 Rabbit Polyclonal Antibody (orb580274) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064575
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WSGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-B315900-500MG 500 mg
Benzyl 2,3,4-Tri-O-benzyl-Alpha-D-mannopyranoside
Sign In for Pricing
View Details 
