METTL1 Peptide - C-terminal region
METTL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
METTL1, C12orf1
UniProt
Q9UBP6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with METTL1 Rabbit Polyclonal Antibody (orb580480) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075422
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ELK1810-01 48 Tests
Human ALPP (Alkaline Phosphatase, Placental) ELISA Kit
Sign In for Pricing
View Details ELK1810-02 96 Tests
Human ALPP (Alkaline Phosphatase, Placental) ELISA Kit
Sign In for Pricing
View Details ELK1810-03 5x 96 Tests
Human ALPP (Alkaline Phosphatase, Placental) ELISA Kit
Sign In for Pricing
View Details GTR15125767 1 Vial
Lentiviral mouse Med20 shRNA (UAS) - Lentiviral mouse Med20 shRNA (UAS) plasmid
Sign In for Pricing
View Details 